Name :
Human CD34 Protein, ECD (Extracellular Domain), Recombinant
Description :
CD34 is a singlepass, type I transmembrane protein belonging to the CD34 family that includes Podocalyxin, and Endoglycan. CD34 is a well-known hematopoietic progenitor cell antigen. It is a sialomucinlike molecule that is heavily glycosylated with 9 potential N-linked glycosylation sites in the extracellular domain. In the cytoplasmic region, CD34 contains serine residues that can be phosphorylated by PKC (protein kinase C), resulting in the recruitment of the hematopoietic adapter proteins and the activation of CD34 signaling pathways. CD34 is expressed on primitive hematopoietic stem cells and down-regulated as they differentiate into mature cells. The precise function of CD34 remains unclear. The pattern of CD34 expression suggests that it plays an important role in hematopoiesis. CD34 is found on multipotent precursors, bone marrow stromal cells, embryonic fibroblasts, vascular endothelia, mesenchymal stem cells, and some tumor cell lines. CD34 is involved in the adhesion of stem cells to the bone marrow extracellular matrix or to stromal cells. It can act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. CD34 is overexpressed in many types of tumors and implicated in leukemogenesis.
Gene Symbol :
The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 – Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.
NCBI Gene ID :
947
Uniprot Entry :
P28906
Construct Details :
The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 – Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.
Source :
Human cells stably expressing human CD34 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQ SQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICL EQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLG ILDFTEQDVASHQSYSQKTSTTENLYFQGSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 30; Estimated by SDS-PAGE under reducing condition (kDa): 75-90 suggesting that the protein may be heavily glycosylated
Calculated PI :
6.16
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 7825
Endotoxin Level :
>92% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Interacts with L-selectin and supports the adhesion of the human umbilical vein endothelial cell line (HUVEC). Binds anti-CD34 monoclonal antibodies, human IgG1 (SKU#MAB0820) and rabbit IgG (SKU#MAB1713) by ELISA with this immobilized protein.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD34
Research Area :
Stem Cell
Pathway/Disease :
Hemopoiesis
Species :
Human
CD Antigen :
CD34
References :
1. Leukemia 2:793-803(1988). 2. J. Biol. Chem. 265:11056-61 (1990). 3. J. Immunol. 148:267-271(1992) 4. Blood 80:3051-59 (1992). 5. Blood 95:756-768 (2000).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TNF-alpha/TNFSF2 Protein
Animal-Free IL-19 Protein
Popular categories:
Thyroxine-Binding Globulin
CD4