Share this post on:

Name :
Human CD28 protein, ECD (extracellular domain), Fc-fusion, recombinant

Description :
CD28 is a single-pass type I transmembrane glycoprotein that belongs to the CD28/CTLA4 (cytotoxic T lymphocyte-associated antigen 4, also known as CD152) family of the immunoglobulin (Ig) superfamily. CD28 and CTLA-4 are structurally homologous molecules and both contain one Ig-like V-type domain in the extracellular region. CD28 and CTLA4 are expressed on the cell surface as disulfide­linked homodimers or as monomers. Together with their ligands, CD80 and CD86, they constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses. CD28 is expressed in T-cells and plasma cells, but not in less mature B-cells. CD28 is involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. CD28 is expressed constitutively on nearly all mouse T cells and surface expression is down­regulated upon ligation of CD28. CTLA­4 is not constitutively expressed but is up­regulated rapidly following T cell activation and CD28 ligation. The binding of CD80 and CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CD28 ligation has also been shown to regulate Th1/Th2 differentiation. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. The CD80/CD86/CD28/CTLA4 pathway can positively and negatively regulate immune responses. CD28 is thus regarded as a promising therapeutic target for autoimmune diseases and cancer.

Gene Symbol :
The recombinant human CD28-Fc fusion is expressed as a 362-amino acid protein consisting of Asn19 – Pro152 region of CD28 (UniProt accession #P10747) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
940

Uniprot Entry :
P10747

Construct Details :
The recombinant human CD28-Fc fusion is expressed as a 362-amino acid protein consisting of Asn19 – Pro152 region of CD28 (UniProt accession #P10747) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing CD28-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFY LQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass 40.7 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation

Calculated PI :
8.19

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds to human B7 family ligands, CD80/B7-1 (SKU#: FCL0716 and FCL0723) and CD86/B7-2 (SKU#: FCL0718 & FCL0725) as well as anti-CD28 monoclonal antibody, human IgG1 (SKU#MAB1827) with high affinity (KD

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD28; TP44; TP-44

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :
CD28

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B3GAT1 Protein
CD40 Protein
Popular categories:
Carboxypeptidase A2
M-CSF R/CD115

Share this post on: