Share this post on:

Name :
Human SLAMF6 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
SLAMF6 (signaling lymphocytic activation molecule family member5), also known as NTB-A and CD352, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF6 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF6 is expressed on the surface of NK, T, and B cells as well as eosinophils. It associates homophilically through weak interactions between the Ig­like V-type domains. SLAMF6 functions as an activating co-receptor on NK and T cells. Tyrosine phosphorylation in the membrane proximal ITSM enables specific association with the adaptor molecules, leading to SLAMF6 mediated cytotoxicity of NK cells and the production of IFN­γ by NK cells. SLAMF6 may also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.SLAMF6 deficient mice show weakened Th2 responses and elevated levels of neutrophil­derived inflammatory mediators. On B cells, SLAMF6 modulates Ig class switching and the balance between tolerance and autoimmunity.

Gene Symbol :
The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 – Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
114836

Uniprot Entry :
Q96DU3

Construct Details :
The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 – Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human SLAMF6-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSL QLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWE ALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKSTGTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 48.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75

Calculated PI :
6.30

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 59985

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized SLAMF6 interacts homophilically with SLAMF6 in a functional ELISA

Molecule Class :
1-pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD352; KALI; NTBA; KALIb; Ly108; NTB-A; SF2000; UNQ6123/PRO20080

Research Area :
Immunology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD352

References :
1. J. Exp. Med. 194:235 (2001). 2. Immunogenetics 53:843 (2002). 3. J Biol. Chem. 279: 18662 (2004). 4. Immunity 25:559 (2006). 5. Science 312:1665 (2006).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
VEGF164 Protein
MMP-9 Protein
Popular categories:
MMP-12
L1 Cell Adhesion Molecule

Share this post on: