Name :
Human SLAMF5 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
SLAMF5 (signaling lymphocytic activation molecule family member5), also known as Ly9B and CD84, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF5 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF5 exhibits extensive, cell typespecific glycosylation and homophilic binding that is mediated by its Iglike V-type domain. The hemophilic interaction induces tyrosine phosphorylation in the cytoplasmic ITSMs, which in turn recruit the signaling adaptor molecules and activates downstream events. SLAMF5 is widely expressed among hematopoietic cells including hematopoietic stem cells, myeloid cells, platelets, megakaryocytes, and lymphocytes. SLAMF5 signaling modulates both adaptive and innate immune responses. It inhibits mast cell activation but enhances platelet activation, macrophage activation, T cell proliferation and IFNγ production as well as the interactions between T cells and B cells for germinal center formation.
Gene Symbol :
The recombinant human SLAMF5-Fc fusion protein is expressed as a 431-amino acid protein consisting of Lys22 – Gly225 region of SLAMF5 (UniProt accession #Q9UIB8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
8832
Uniprot Entry :
Q9UIB8
Construct Details :
The recombinant human SLAMF5-Fc fusion protein is expressed as a 431-amino acid protein consisting of Lys22 – Gly225 region of SLAMF5 (UniProt accession #Q9UIB8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF5-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVIS DLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGE EGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGSTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
Calculated PI :
6.04
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 61935
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized SLAMF5 interacts homophilically with SLAMF5 in a functional ELISA and enhances the proliferation of PHA-stimulated T cells in the presence of anti-CD3e antibody
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD84; LY9B; Hly9-beta; hCD84; mCD84; SLAMF-5; MAX.3
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD84
References :
1. Blood, 90: 2398-2405 (1997). 2. J. Immunol. 167:3668 (2000). 3. J. Immunol. 167: 3668-3676 (2001).. 4. Proc. Natl. Acad. Sci. 104: 10583-10588 (2007). 5. Annu. Rev. Immunol. 29:665 (2011).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OSTM1 Protein
IL-5 Protein
Popular categories:
Liver Receptor Homolog-1
Neuronal Cell Adhesion Molecule
