Share this post on:

Name :
Human SLAMF2 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
SLAMF2 (signaling lymphocytic activation molecule family member2), also known as BLAST­1 and CD48, is a GPI­anchored glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF2 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region. SLAMF2 is expressed on most lineage­committed hematopoietic cells but not on hematopoietic stem cells or progenitors. CD48 plays important roles in a variety biological processes including adhesion, pathogen recognition, cellular activation, and cytokine regulation, and emerges as a critical effector molecule in immune responses. CD2, SLAMF4 (also known as 2B4 and CD244), and heparan sulfate function as CD48 ligands. In mice, CD48­CD2 interactions promote T cell activation and class switching to IgG2a in B cells. In human, high affinity CD48­CD244 interactions can either promote or inhibit NK cell and cytotoxic T cell (CTL) activation. A soluble form of CD48 is detected in the serum of lymphoid leukemia and arthritis patients.

Gene Symbol :
The recombinant human SLAMF2-Fc fusion protein is expressed as a 421-amino acid protein consisting of Gln27 – Arg219 region of SLAMF2 (UniProt accession #P09326) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
962

Uniprot Entry :
P09326

Construct Details :
The recombinant human SLAMF2-Fc fusion protein is expressed as a 421-amino acid protein consisting of Gln27 – Arg219 region of SLAMF2 (UniProt accession #P09326) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human SLAMF2-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQK EDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKEL QNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 47.8; Estimated by SDS-PAGE under reducing condition (kDa): 60-70

Calculated PI :
8.44

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 73060

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized SLAMF2 interacts heterophilically with CD2 and SLAMF4/CD244/2B4 (SKU#FCL0791)

Molecule Class :
GPI-anchored Protein

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD48; BCM1; BLAST; hCD48; mCD48; BLAST1; BLAST-1; SLAMF-2; MEM-102

Research Area :
Immunology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD48

References :
1. J. Exp. Med. 171: 2115-2130 (1990). 2. J. Exp. Med. 176:1241 (1992). 3. J Immunol. 159 (8): 3910-3920 (1997). 4. J. Clin. Immunol. 17:502 (1997). 5. Cell 121:1109 (2005).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NKp30/NCR3 Protein
BAG-2 Protein
Popular categories:
GPC-3
Cathepsin X/Cathepsin Z

Share this post on: