Name :
Human NECL2 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
NECL2 (Nectin-like protein 2), also known as IgSF4 and CADM1 (cell adhesion molecule 1), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL2 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that mediates calcium-independent adhesive interactions, either homophilic or heterophilic with CRTAM (class Irestricted T cellassociated molecule), Necl1 or Nectin3. NECL2 is found on mast cells, neurons, and dendritic cells. Necl2 is also known s TSLC1 (tumor suppressor in lung cancer1). It is downregulated in nonsmall cell lung cancer. This may allow evasion of antitumor responses, as NECL2 interacts with CRTAM on activated NK and CD8+ T cells and stimulates cytotoxicity. NECL2 binds homotypically across synaptic clefts and promotes formation of neural cell synapses. Expression on mast cells allows attachment to neurites and fibroblasts. NECL2 contains a cytoplasmic domain with protein 4.1 and PDZ domain binding sites, allowing connections to adaptor molecules that are critical for synaptogenesis.
Gene Symbol :
The recombinant human NECL2-Fc fusion protein is expressed as a 531-amino acid protein consisting of Gln451 – His346 region of NECL2 (UniProt accession #Q9BY67 – isoform 5) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
23705
Uniprot Entry :
Q9BY67
Construct Details :
The recombinant human NECL2-Fc fusion protein is expressed as a 531-amino acid protein consisting of Gln451 – His346 region of NECL2 (UniProt accession #Q9BY67 – isoform 5) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human NECL2-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELK VSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASK PATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRY LEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGSIRAVDHGSTGTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 70-80
Calculated PI :
5.49
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 70540
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized NECL2 binds CRTAM/CD355 (SKU#FCL1027) in a functional ELISA
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CADM1; BL2; ST17; IGSF4; RA175; TSLC1; IGSF4A; Necl-2; SYNCAM; sgIGSF; sTSLC-1; synCAM1; TSLC-1
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
References :
1. Science 297:1525 (2002). 2. Nat. Genet. 27:427 (2002). 3. J. Biol. Chem. 278:35421 (2003). 4. Oncogene 23:5687 (2004). 5. J. Immunol. 174:6934 (2005).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
L-xylulose reductase/DCXR Protein
BPI Protein
Popular categories:
Neuronal Cell Adhesion Molecule
Ubiquitin-Specific Peptidase 34
