Share this post on:

Name :
Human NECL1 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
NECL1 (Nectin-like protein 1), also known as IgSF4B and CADM3 (cell adhesion molecule 3), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL1 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL1 is a neural tissue-specific Ig-like CAM with Ca2+-independent homo- or heterophilic cell-cell adhesion activity. NECL1 may play an important role in the formation of synapses, axon bundles and myelinated axons. It may also act as a tumor suppressor in glioma and loss of it in glioma may be caused by histone deacetylation. NECL1 suppresses the growth and tumorigenic ability of colon cancer cells.

Gene Symbol :
The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 – Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
57863

Uniprot Entry :
Q8N126

Construct Details :
The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 – Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human NECL1-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSI SISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWR KGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMI RPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSY KAYYTLNVNDPSPVPSSSSTYHASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 59.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70

Calculated PI :
6.43

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 73060

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized NECL1 protein supports the adhesion of C6 rat brain glial cells and enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons

Molecule Class :
1-pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CADM3; CAMD-3; BIgR; NECL-1; TSLL1; IGSF4B; synCAM3; UNQ225/PRO258

Research Area :
Neuroscience

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :

References :
1. Oncogene 20: 5401 (2001). 2. Genome Res. 13: 2265 (2003). 3. Gene 323:11 (2003). 4. J. Biol. Chem. 278:35421 (2003). 5. J. Biol. Chem. 281:10610 (2006).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EphA2 Protein
PSMA Protein
Popular categories:
IFN-ω
Transforming Growth Factor-β

Share this post on: