Share this post on:

Name :
Human PD-L2 protein (extracellular domain), biotinylated, recombinant

Description :
PD-L2 (programmed death ligand 2), also referred to as B7-DC or CD273, is a single pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. It was originally identified as a homolog of PD-L1. Like PD-L1 and other B7 family members, PD-L2 contains one Ig V-like and one Ig C-like domain in the extracellular region. Among the family members, they share about 20-25% amino acid identity. PD­L1 and PD­L2 share ~41% amino acid sequence identity and have similar functions. PD-L2 is expressed on antigen presenting cells, placental endothelium and medullary thymic epithelial cells, and can be induced by LPS and INF-γ. PD-L2 and PD-L1 are two ligands for PD-1/CD279, a member of the CD28/CTLA4 family receptors that play critical roles in regulating T cell activation and immune tolerance. Interaction with PD-1, which has a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), inhibits T-cell proliferation and cytokine production. PD-L2 is also a dendritic cell molecule with co-stimulatory properties for T cells. The interaction of PD-L2/PD-1 has a 2-6-fold higher affinity than that of B7-H1/PD-1.

Gene Symbol :
The recombinant human PD-L2 ECD is expressed as a 212 amino acid protein consisting of Leu20 – Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation.

NCBI Gene ID :
80380

Uniprot Entry :
Q9BQ51

Construct Details :
The recombinant human PD-L2 ECD is expressed as a 212 amino acid protein consisting of Leu20 – Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation.

Source :
Human cells stably expressing PD-L2 ECD and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGK ASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYP LAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQME PRTHPTSTGHHHHHHHH

M.W. :
Calculated molecular mass 24 kDa; estimated by SDS-PAGE under reducing condition ~45 kDa (probably due to glycosylation)

Calculated PI :
6.61

Calculated Extinction Coefficients :

Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds to its receptor PD-1 (SKU#: FCL0763 and FCL0761) and induce the receptor-mediated signaling activity.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD273; B7-DC; PDL2; PDCD1LG2; B7DC; CD273; PDCD1L2; PDL2

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :
CD273

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Profilin-2 Protein
CD200 Protein
Popular categories:
VRK Serine/Threonine Kinase 1
Frizzled-8

Share this post on: