Name :
Human NCR3 Protein ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
NCR3 (natural cytotoxicity triggering receptor 3), also known as NKp30 and CD337, is a single pass type I transmembrane glycoprotein that belongs to the NCR family of the Ig (immunoglobulin) superfamily. Like other family members, NCR3 contains a single Ig-like V-type domain in the extracellular region. Cytotoxicity of natural killer (NK) cells is regulated by a balance of signals from two types of NK receptors, activating receptors and inhibitory receptors. NCR3 is a major NK activating receptor. NCR3 is selectively expressed in all resting and activated NK cells. It plays a key role in NK-mediated killing of tumor cells. NCR3 is also involved in NK-mediated induction of dendritic cell (DC) maturation. NCR3 forms a complex with an ITAM-bearing accessory protein CD3ζ, which undergoes phosphorylation upon a specific antibody ligation. Studies with neutralizing antibodies reveal that NCR3 is partially responsible for triggering lytic activity against several tumor cell types and that it is the main receptor responsible for NKmediated lysis of immature dendritic cells. The B7 family member B7-H6 has been identified as a tumor cell ligand for the activating natural killer cell receptor NCR3 in humans.
Gene Symbol :
The recombinant human NCR3-Fc fusion is expressed as a 345 amino acid protein consisting of Leu19 – Gly135 region of NCR3 (UniProt accession #O14931) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
259197
Uniprot Entry :
O14931
Construct Details :
The recombinant human NCR3-Fc fusion is expressed as a 345 amino acid protein consisting of Leu19 – Gly135 region of NCR3 (UniProt accession #O14931) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing human NCR3-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLH DHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~50
Calculated PI :
7.29
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 48400
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its ligand B7-H6 (SKU#FCL1178) in a functional ELISA and blocks B7-H6-induced IFN-γ secretion by NK cells.
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
NCR3; CD337; NKp30; NK-p30; 1C7; MALS; LY117; NCTR3; NCR-3
Research Area :
Immunology
Pathway/Disease :
NK Cell Activation
Species :
Human
CD Antigen :
CD337
References :
1. J. Exp. Med. 190:1505 (1999). 2. J. Exp. Med. 195:343 (2002). 3. J. Immunol. 174:2653 (2005). 4. J. Immunol. 179:7385 (2007). 5. J. Exp. Med. 2061495 (2009)
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
C1QA Protein
OX40 Ligand/TNFSF4 Protein
Popular categories:
CTAP-III/CXCL7
Protease-activated Receptor