Name :
Human FGFR4 Protein, ECD (Extracellular Domain), Biotinylated, Recombinant
Description :
FGFR4 (fibroblast growth factor receptor 4), also known as JTK2 and CD334, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family. There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)like domains, an acidbox region, a transmembrane domain and a cytoplasmic tyrosinekinase domain. FGFR4 is reported to be a high affinity receptor for both acidic and basic fibroblast growth factor, and also binds to FGF8, 15, and 19. FGFR4 associates with βKlotho and sulfated glycosaminoglycans, and these interactions increase the affinity of FGFR4 for its ligands and its signaling capacity. Growing studies have indicated that FGFR4 plays a role in tumor progression in human cancer. It plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, glucose uptake, vitamin D metabolism and phosphate homeostasis. FGFR4 supports glucose tolerance and insulin sensitivity and protects against hyperlipidemia.
Gene Symbol :
The recombinant human FGFR4 ECD is expressed as a 360 amino acid protein consisting of Leu22 – Asp369 region of FGFR4 (Uniprot accession #P22455 – isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions (see the gel image inserted).
NCBI Gene ID :
2264
Uniprot Entry :
P22455
Construct Details :
The recombinant human FGFR4 ECD is expressed as a 360 amino acid protein consisting of Leu22 – Asp369 region of FGFR4 (Uniprot accession #P22455 – isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions (see the gel image inserted).
Source :
Human cells stably expressing FGFR4 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGR LEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYW THPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMES VVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDA QPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGL SYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 39.9; Estimated by SDS-PAGE under reducing condition (kDa): 50-60
Calculated PI :
6.01
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 63870
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecule Class :
Receptor Tyrosine Kinase (RTK)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
FGFR4; CD334; FGFR-4; TKF; JTK2; JTK-2
Research Area :
Metabolism
Pathway/Disease :
FGF/FGFR Signaling Pathway
Species :
Human
CD Antigen :
CD334
References :
1. EMBO. J. 10: 1347-1354 (1991). 2. J. Biol. Chem. 268:5388-5394 (1993). 3. Development 113:641 (1991). 4. Cancer. Res. 62: 840-847 (2002). 5. Diabetes 56:2501 (2007).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CYP21A2 Protein
APRIL/TNFSF13 Protein
Popular categories:
Ubiquitin-Specific Peptidase 44
GPR49
