Name :
Human EGFR protein (extracellular domain), Fc-fusion, recombinant
Description :
EGFR is known as epidermal growth factor receptor, proto-oncogene c-ErbB-1 , receptor tyrosine-protein kinase erbB-1. It is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK). Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4). They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity. The human EGFR has 1210 amino acid (aa), including a 24 aa signal peptide, a 621 aa ECD, and a 23 aa TM segment. It shares 88% aa sequence identity with murine EGFR and 43-44% identity with the ECD of other 3 human EGFR members. EGFR binds to a subset of the EGF family ligands, including EGF, amphiregulin, TGFα, β-cellulin, epiregulin, HB-EGF, and epigen. EGFR signaling is initiated by ligand binding, leading to EGFR receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain and receptor activation. Subsequently, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation. EGFR is known to form heterodimers with the ligand-activated HER3 or HER4. EGFR is overexpressed in a variety of tumors. Mutations in EGFR gene are associated with lung cancer. EGFR is the target of several anti-cancer therapeutics.
Gene Symbol :
NCBI Gene ID :
1956 (human)
Uniprot Entry :
P00533 (human)
Construct Details :
The recombinant human EGFR extracellular or ecto-domain (ECD) is expressed as a 850 amino acid protein consisting of Leu25-Thr638 region of EGFR and a C-terminal Fc fusion from human IgG1 which exists as a dimer under non-reducing condition (see the gel image, labeled as DTT “-“)
Source :
Human cells stably expressing human EGFR-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL QIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHL GSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTC PPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGE FKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLE IIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ VCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH YIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTSTGDEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 94.4; Estimated by SDS-PAGE under reducing condition (kDa): ~100
Calculated PI :
6.49
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 95750
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
The recombinant Fc-fusion protein blocks anti-EGFR mAbs (Cat#MAB0118, #MAB0520) and therapeutic mAb such as Erbitux and Vectbix binding to EGFR ECD (SKU#FCL0169) as measured by ELISA and to cell surface EGFR by flow cytometry or cell-based ELISA.
Molecule Class :
Receptor Tyrosine Kinase (RTK)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
EGFR; ERBB; ERBB1; HER1; mENA; PIG61; SA7
Research Area :
Cancer
Pathway/Disease :
EGF/PDGF Signaling Pathway
Species :
Human
CD Antigen :
References :
1. Science 306: 1506-1507, 2004.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD40 Protein
Biliverdin Reductase A/BLVRA Protein
Popular categories:
Contactin-4
Ubiquitin-Specific Peptidase 26
