Name :
Human CDNF protein, biotinylated, recombinant
Description :
CDNF (cerebral dopamine neurotrophic factor or conserved dopamine neurotrophic factor) is also known as ARMETL1 (argininerich, mutated in early stage tumors-like 1) in mouse. Mature CDNF protein consists of 161 amino acid residues (its precursor has 187 amino acids), and shares 62% amino acid (aa) identity with human MANF (mesencephalic astrocytederived neurotrophic factor), termed ARMET in mouse. CDNF was first identified by bioinformatics and then biochemically characterized. Vertebrates appear to have CDNF and MANF genes, whereas invertebrates have a single homologous gene more closely related to MANF than to CDNF. Mature human CDNF shares 80%, 84%, 90% and 92% aa identity with mouse, rat, equine and bovine CDNF, respectively. Human CDNF contains one potential N-linked glycosylation site, and both unglycosylated and glycosylated form of human CDNF is secreted from transiently overexpressing cells. Both CDNF and MANF have a high proportion of charged residues, a pattern of eight cysteines shown to form intramoleculular disulfides, and a C-terminal endoplasmic reticulum retention signal. The CDNF gene is widely expressed in neuronal and non-neuronal tissues. In the brain, highest levels in the optic nerve and corpus callosum. Although CDNF mRNA and protein are expressed in pre and postnatal mouse brain, they are most abundant in adult heart, skeletal muscle and testis. Similar to MANF and GDNF, CDNF promotes survival of dopaminergic neurons in vitro. In a rat Parkinson’s disease model, CDNF also promotes rescue and restoration of dopaminergic neurons in vivo.
Gene Symbol :
NCBI Gene ID :
441549
Uniprot Entry :
Q49AH0
Construct Details :
The recombinant human CDNF is expressed as a 174 amino acid protein consisting of Gln25 – Leu187 region of CDNF (UniProt entry Q49AH0) and a C-terminal poly-Histidine tag.
Source :
Human cells stably expressing CDNF and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVH MPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTELS TGHHHHHHHH M.W.: Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state. Calculated PI: 7.75 Calculated Extinction Coefficient: 14940 (M-1 cm-1, at 280nm) Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, sample is labeled as “S” and “M” stands for markers) Formulation:Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure. Endotoxin Level: Biological Activity: CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 – 24 μg/mL on a nitrocellulose coated microplate
M.W. :
Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state.
Calculated PI :
7.75
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, sample is labeled as “S” and “M” stands for markers)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 – 24 μg/mL on a nitrocellulose coated microplate
Molecule Class :
Neurotrophic Growth Factor (secreted)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CDNF; ARMETL1
Research Area :
Neuroscience
Pathway/Disease :
Neurological Development & Degenerative Disease
Species :
Human
CD Antigen :
References :
1. Develop Neurobiol 70: 360, 2010
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Sap130 Protein
IL-17RA Protein
Popular categories:
Cyclin-Dependent Kinase 2 (CDK2)
DNGR-1/CD370