Name :
Human 4-1BB/CD137 Protein, ECD, Fc-fusion, Biotinylated, Recombinant
Description :
4-1BB, also known as CD137, ILA and TNFRSF9, is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). 41BB is expressed as a disulfidelinked homodimer on activated T cells. 4-1BB is absent from naive T cells, but its expression is induced by lymphocyte activation. 4-1BB is the receptor for 4-1BB ligand/TNFSF9, which is expressed on antigen-presenting cells such as macrophages and activated B cells. 4-1BB mediated signaling pathway contributes to the proliferation, survival, and development of T cells. 4-1BB can also promote proliferation in peripheral monocytes, enhance T cell apoptosis triggered by TCR-CD3 activation, and regulate CD28 co-stimulation to promote Th1 cell responses. 41BB deficient mice show augmented T cell activation. 4-1BB and its ligand are also expressed in different human tumor tissues. 4-1BB activation by crosslinking with its ligand or agonistic antibody enhances cytotoxic T cell and NK cell mediated antitumor immunity. 4-1BB can interact with OX40 on activated T cells, forming a complex that responds to either ligand and inhibits Treg and CD8+ T cell proliferation. 4-1BB may also be involved in the development of inflammation in high fat dietinduced metabolic syndrome. The soluble form of 4-1BB circulates at elevated levels in the serum of rheumatoid arthritis.
Gene Symbol :
4-1BB;CD137; ILA; TNFRSF9; CDw137; MGC2172
NCBI Gene ID :
3604
Uniprot Entry :
Q07011
Construct Details :
The recombinant human 4-1BB-Fc fusion is expressed as a 390 amino acid protein consisting of Leu24 – Gln186 region of 4-1BB (UniProt accession #Q07011) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions (see the gel image above).
Source :
Human cells stably expressing human 4-1BB/CD137 and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNA ECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKS VLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 42.8; Estimated by SDS-PAGE under reducing condition (kDa): 55-60
Calculated PI :
7.72
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 42535
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its ligand human 4-1BBL and anti-4-1BB monoclonal antibodies (SKU#MAB1829) with high affinity by ELISA (see Technical Data). Blocks 4-1BBL/4-1BB-induced signaling activity.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD137; ILA; TNFRSF9; CDw137; MGC2172
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD137
References :
1. J. Immunol. 168:4897 (2002). 2. Nat. Immunol. 9:917 (2008). 3. Trends Pharmacol. Sci. 29(8): 383 (2008). 4. Immunol. Rev. 229:192 (2009). 5. Diabetes 60:3159 (2011).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGFBP-5 Protein
CD8 alpha Protein
Popular categories:
Viral Proteins
IL-18RAP