Share this post on:

Name :
Human FGFR1 Protein, ECD (Extracellular Domain), Recombinant

Description :
FGFR1 (fibroblast growth factor receptor 1), also known as FLT-2 and CD331, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family. There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)­like domains, an acid­box region, a transmembrane domain and a cytoplasmic tyrosine­kinase domain. FGFR1 is the receptor for FGF basic and also interacts with GRB14, SHB, FRS2. The extracellular region of FGFR1 interacts with FGFs, setting in motion a cascade of downstream signals, ultimately leading to mitogenesis and differentiation. FGFR1 plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. It is required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Defects in FGFR1 are the cause of several diseases, such as Kallmann syndrome type 2 (KAL2), osteoglophonic dysplasia (OGD), and Pfeiffer syndrome (PF). Chromosomal aberrations involving FGFR1 are associated with stem cell leukemia lymphoma syndrome (SCLL) and stem cell myeloproliferative disorder (MPD).

Gene Symbol :
The recombinant human FGFR1 ECD protein is expressed as a 275 amino acid protein consisting of Arg22 – Glu285 region of FGFR1 (Uniprot accession #P11362 – isoform 15) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 6 potential N-linked glycosylation sites.

NCBI Gene ID :
2260

Uniprot Entry :
P11362

Construct Details :
The recombinant human FGFR1 ECD protein is expressed as a 275 amino acid protein consisting of Arg22 – Glu285 region of FGFR1 (Uniprot accession #P11362 – isoform 15) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 6 potential N-linked glycosylation sites.

Source :
Human cells stably expressing FGFR1 ECD and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
RPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFK CPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPY VQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSP LYLESTGHHHHHHHH

M.W. :
Calculated molecular mass (kDa): 30.8; Estimated by SDS-PAGE under reducing condition (kDa): ~55

Calculated PI :
5.83

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 42650

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.

Molecule Class :
Receptor Tyrosine Kinase (RTK)

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
FGFR1; CD331; FGFR-1; CEK; FLG; HH2; OGD; c-Fgr; FLT2; KAL2; BFGFR; FGFBR; FLT-2; HBGFR; N-SAM; HRTFDS; bFGF-R-1

Research Area :
Development

Pathway/Disease :
FGF/FGFR Signaling Pathway

Species :
Human

CD Antigen :
CD331

References :
1. J. Biol. Chem. 271: 1726-1731 (1996). 2. Biochem. Cell Biol. 75:669 (1997). 3. Proc. Natl. Acad. Sci. 97: 49-54 (2000). 4. Nature. 407: 1029-1034 (2000). 5. Nature Genetics. 39: 870-874 (2007).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD98 Protein
Nectin-1 Protein
Popular categories:
Ubiquitin-Specific Peptidase 46
Calcineurin B

Share this post on: