Share this post on:

Name :
Human NECL5/CD155/PVR Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
NECL5 (Nectin-like protein 5), also known as PVR (poliovirus receptor) and CD155, is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL5 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL5 is predominately expressed in enterocytes and gastrointestinal lymphatic tissues. It was originally identified by the ability to mediate the cell attachment and entry of poliovirus (PV), an etiologic agent of the central nervous system disease poliomyelitis. The normal cellular function of NECL5 maybe the involvement of intercellular adhension between epithelial, endothelial, and immune cells. NECL5 interact with CD226 and CD96, which promote the adhension, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. Enhanced NECL5 expression in tumor cells contributes to loss of contact inhibition and increased migration. It also allows tumor cell recognition and killing by CD226­ or CD96­expressing NK cells. NECL5 also binds the inhibitory ligand TIGIT (T-cell immunoreceptor with Ig and ITIM domains) on NK and some mature T cells, antagonizing CD226 effects.

Gene Symbol :
The recombinant human NECL5-Fc fusion protein is expressed as a 552-amino acid protein consisting of Trp21 – Asn343 region of NECL5 (UniProt accession #15151 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
5817

Uniprot Entry :
P15151

Construct Details :
The recombinant human NECL5-Fc fusion protein is expressed as a 552-amino acid protein consisting of Trp21 – Asn343 region of NECL5 (UniProt accession #15151 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human NECL5-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESK RLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEP VPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEK PQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNGSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 60.7; Estimated by SDS-PAGE under reducing condition (kDa): 75-85

Calculated PI :
6.26

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 86580

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized NECL5 interacts with CD226 (SKU#FCL1028) in a functional ELISA

Molecule Class :
1-pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
NECL5; CD155; PVR; PVS; HVED; NECL-5; TAGE4; Necl-5

Research Area :
Cancer

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD155

References :
1. J. Biol. Chem. 278:31251 (2003). 2. J. Exp. Med. 199:1331 (2004). 3. Eur. J. Immunol. 37 :2214 (2007). 4. Proc. Natl. Acad. Sci. 106:17858 (2009). 5. J. Immunol. 184:902 (2010).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HN1 Protein
TrkB Protein
Popular categories:
Cyclin Dependent Kinase 1 (CDK1)
BMP-3B/GDF10

Share this post on: