Name :
Human NECL1 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
NECL1 (Nectin-like protein 1), also known as IgSF4B and CADM3 (cell adhesion molecule 3), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL1 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL1 is a neural tissue-specific Ig-like CAM with Ca2+-independent homo- or heterophilic cell-cell adhesion activity. NECL1 may play an important role in the formation of synapses, axon bundles and myelinated axons. It may also act as a tumor suppressor in glioma and loss of it in glioma may be caused by histone deacetylation. NECL1 suppresses the growth and tumorigenic ability of colon cancer cells.
Gene Symbol :
The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 – Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
57863
Uniprot Entry :
Q8N126
Construct Details :
The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 – Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human NECL1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSI SISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWR KGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMI RPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSY KAYYTLNVNDPSPVPSSSSTYHASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 59.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
Calculated PI :
6.43
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 73060
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized NECL1 protein supports the adhesion of C6 rat brain glial cells and enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CADM3; CAMD-3; BIgR; NECL-1; TSLL1; IGSF4B; synCAM3; UNQ225/PRO258
Research Area :
Neuroscience
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
References :
1. Oncogene 20: 5401 (2001). 2. Genome Res. 13: 2265 (2003). 3. Gene 323:11 (2003). 4. J. Biol. Chem. 278:35421 (2003). 5. J. Biol. Chem. 281:10610 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DDX5 Protein
CD38 Protein
Popular categories:
KIR2DS4
BMP-8b