Share this post on:

Name :
Human sFRP1 Protein, Fc-fusion, Recombinant

Description :
sFRP1 (secreted Frizzled-related protein 1), also known as FRP1 and SARP-2, is the founding member of the sFRP family. sFRP family consists of at least 5 secreted glycoproteins that act as extracellular signaling ligands. Each sFRP contains a signal peptide, a cysteine-rich domain (CRD) that shares 30-50% homology with that of Fz (Frizzled) receptors, and a C­terminal heparin­binding region with weak homology to NTR (Netrin). sFRPs function as soluble modulators of Wnt signaling, which plays a key role in embryonic development, cell differentiation and cell proliferation. sFRPs may counteract Wnt-induced effects at high concentrations and promote them at lower concentrations. sFRPs can bind Wnt proteins and Fz receptors in the extracellular compartment. The interaction between sFRPs and Wnt proteins prevents the latter from binding the Fz receptors. sFRP1 is widely expressed with highest levels in heart and fetal kidney. sFRP1 has diverse activities, from inducing angiogenesis to helping regulate Wnt­4 signaling (with sFRP­2) in renal organogenesis . sFRP1 decreases intracellular beta-catenin levels and exhibits antiproliferative effects on vascular cells. sFRP1 has been characterized as a tumor suppressor in breast and cervical cancer. SFRP1 is also found in malignant gliomas and may contribute to the development of uterine leiomyomas.

Gene Symbol :
The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 – Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
6422

Uniprot Entry :
Q8N474

Construct Details :
The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 – Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human sFRP1-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNK NCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNAT EASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLV LYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK

M.W. :
Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85

Calculated PI :
8.76

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 72195

Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED50 of 0.2 – ­0.8 µg/mL

Molecule Class :
Ligand (secreted)

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
sFRP-1; FRP; FRP1; FrzA; FRP-1; SARP2; SARP-2

Research Area :
Stem Cell

Pathway/Disease :
Wnt/β-catenin Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Proc. Natl. Acad. Sci. 94: 2859 (1997). 2. Proc. Natl. Acad. Sci. 94:6770 (1997). 3. Oncogene 19:4210 (2000). 4. J. Biol. Chem. 282:20523 (2007). 5. Stem Cells. 26: 35-44 (2008).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-31R alpha Protein
HAS2 Protein
Popular categories:
IFN-alpha 14
CD284/TLR4

Share this post on: