Share this post on:

Name :
Human SLAMF3 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
SLAMF3 (signaling lymphocytic activation molecule family member 3), also known as Ly9 and CD229, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF3 contains 2 Ig-like V-type and 2 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF3 is expressed on lymphocytes, thymocytes, and more weakly on NK cells. SLAMF3 cell surface expression on lymphocytes surface is differentially regulated within the SLAM family members. SLAMF3 is a pan-lymphocyte marker and antibodies against it are able to down-regulate T-cell activation. Homophilic interactions between SLAMF3 are mediated through its Ig­like domains and involved in the immunological synapse. Antigen stimulation of lymphocytes induces SLAMF3 clustering to the sites of T cell and B cell contact. Two tyrosines in the cytoplasmic domain are required for association with adaptor proteins and internalization. It has been reported that human and mouse SLAMF3 show cross­species binding.

Gene Symbol :
The recombinant human SLAMF3-Fc fusion protein is expressed as a 540-amino acid protein consisting of Lys48 – Arg359 region of SLAMF3 (UniProt accession #Q9HBG7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
4063

Uniprot Entry :
Q9HBG7

Construct Details :
The recombinant human SLAMF3-Fc fusion protein is expressed as a 540-amino acid protein consisting of Lys48 – Arg359 region of SLAMF3 (UniProt accession #Q9HBG7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human SLAMF3-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
KDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISN LTLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTP REPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVT LPLALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYV CSEASSVTSMTHVTLLIYRRSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 75-85

Calculated PI :
6.31

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 78685

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized SLAMF3 binds homophilically to biotinylated SLAMF3 in a functional ELISA

Molecule Class :
1-pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD229; Ly9; hly9; mLY9; Ly-9; SLAMF-3; CDABP0070

Research Area :
Immunology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD229

References :
1. Immunogenetics 11:65 (1980). 2. J. Immunol. 125:2127 (1980). 3. J. Immunol. 149:1636 (1992). 4. Blood 97:3513 (2001). 5. J Immunol. 174: 5977-86 (2005).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Apolipoprotein E/APOE Protein
VEGF-DD Protein
Popular categories:
Adrenomedullin
CD217

Share this post on: