Share this post on:

Name :
Human SLAMF1 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
SLAMF1 (signaling lymphocytic activation molecule family member1), also known as SLAM and CD150, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF1 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 3 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF1 is expressed on lymphocytes, thymocytes, macrophages, dendritic cells, platelets, and hematopoietic stem cells. Its expression is up­regulated on lymphocytes cells after activation. As a self-ligand, SLAMF1 plays an important role in bidirectional T-cell to B-cell stimulation. It performs diverse immunologic functions including T/B-cell costimulation, induction of interferon-γ in Th1 T-cell clones, redirection of Th2 clones to a Th1 or Th0 phenotype, and inhibition of apoptosis in B cells. SLAMF1 ligation also promotes an allergen­induced eosinophil and mast cell activation, NKT cell development, and the microbicidal response of macrophages. In human, SLAMF1 also functions as a cellular entry receptor for measles virus.

Gene Symbol :
The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 – Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
6504

Uniprot Entry :
Q13291

Construct Details :
The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 – Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human SLAMF1-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYK FYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAY SWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPSTGTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 49.9; Estimated by SDS-PAGE under reducing condition (kDa): 65-75

Calculated PI :
8.17

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 66070

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Co-stimulates IL-4 secretion by T cells in the presence of anti-CD3e antibody

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD150; SLAM; CDw150; IPO-3; SLAMF-1

Research Area :
Immunology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD150

References :
1. Nature 376: 260-263 (1995). 2. Nature 406: 893-897 (2000). 3. Nature Immunol. 4: 19-24 (2003). 4. J. Exp. Med. 185:993 (1997). 5. J. Immunol. 158:4036 (1997).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-21 Protein
NRAS Protein
Popular categories:
Protocadherin-10
PTPN3

Share this post on: