Share this post on:

Name :
Human CD86 Protein, ECD (Extracellular Domain), Recombinant

Description :
CD86, also known as the B-lymphocyte activation antigen B7-2, is a single-pass type I transmemebrane glycoprotein that belongs to the B7 family of the Ig superfamily. Like other B7 family members, CD86 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD86 is constitutively expressed on interdigitating dendritic cells, Langerhans cells, peripheral blood dendritic cells, memory B cells, and germinal center B cells. CD86 provides a co-stimulatory signal necessary for T cell activation and survival. It exists predominantly as a monomer on cell surfaces and interacts with two receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD86 works in tandem with CD80 (also known as B7-1) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL. The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD86 promotes APC (antigen presenting cell) diversity, function and survival. CD80 and CD86 may act as a receptor for adenovirus subgroup B. CD86 plays an important role in chronic hemodialysis, allergic pulmonary inflammation, arthritis, and antiviral responses, and is thus regarded as a promising target for autoimmune diseases and cancer.

Gene Symbol :
The recombinant human CD86 ECD protein is expressed as a 235 amino acid protein consisting of Ala24 – Pro247 region of CD86 (UniProt accession #P42081) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.

NCBI Gene ID :
942

Uniprot Entry :
P42081

Construct Details :
The recombinant human CD86 ECD protein is expressed as a 235 amino acid protein consisting of Ala24 – Pro247 region of CD86 (UniProt accession #P42081) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.

Source :
Human cells stably expressing CD86 ECD and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLR LHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKM SVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPP PDHIPSTGHHHHHHHH

M.W. :
Calculated molecular mass 26.9 kDa; estimated by SDS-PAGE under reducing condition 50-60 kDa probably due to glycosylation

Calculated PI :
5.88

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds human CD28 and induces IL-2 secretion by Jurkat human acute T cell leukemia cells

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
B7-2; B7.2; B70; BU63; FUN-1; CD28LG2; LAB72

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :
CD86

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free IL-11 Protein
SMR3B Protein
Popular categories:
Artemin
DDR2

Share this post on: