Name :
Human ICOS protein, ECD (extracellular domain), Fc-fusion, recombinant
Description :
CD278, also known as ICOS (inducible co-stimulator), is a single-pass type I transmembrane glycoprotein that belongs to the CD28/CTLA4 (cytotoxic T lymphocyte-associated antigen 4, or CD152) family of the immunoglobulin (Ig) superfamily. Like other family members, CD28, CTLA4 and PD-1, CD278/ICOS contains one Ig-like V-type domain in the extracellular region and shares 39% amino acid similarity with CD28 and CTLA4. ICOS is expressed on most CD45RO+ cells and is upregulated after the activation on Th primed cells. B7H2, a member of the B7 family of co-stimulatory ligands, has been identified as the ICOS ligand (ICOSL). Optimal T cell activation and expansion are regulated by signals delivered not only through the T cell receptor (TCR), but also a number of co-stimulatory molecules, including ICOS and ICOSL. ICOS is expressed on antigen-primed T cells, and ICOSL is expressed mainly on B cells and macrophages. The interaction of B7-H2/ICOS plays critical roles in T cell dependent B cell activation and in Th cell differentiation. These T−B cell interactions are essential for germinal center formation, and humoral immune responses, and as well as the production of cytokine IL-4. In addition, ICOS also regulates TH2-mediated mucosal inflammatory responses, and aberrant expression of ICOS has been implicated in allergic inflammatory responses and other immune disorders.
Gene Symbol :
NCBI Gene ID :
29851
Uniprot Entry :
Q9Y6W8
Construct Details :
The recombinant human ICOS-Fc fusion protein is expressed as a 348-amino acid protein consisting of Glu21 – Lys140 region of ICOS (UniProt accession #Q9Y6W8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing ICOS-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSF FLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKSTGTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 39.2 kDa; estimated by SDS-PAGE under reducing condition ~55 kDa probably due to glycosylation
Calculated PI :
7.98
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its ligand ICOSL/B7-H2/CD275 and inhibits human T cell proliferation induced by ICOSL in the presence of anti-CD3e antibody.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD278; AILIM; CVID1
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD278
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Insulin Protein
Claudin-6/CLDN6 Protein-VLP
Popular categories:
ADAMTS12
FGFR-2