Share this post on:

Name :
Human CD34 Protein, ECD (Extracellular Domain), Recombinant

Description :
CD34 is a single­pass, type I transmembrane protein belonging to the CD34 family that includes Podocalyxin, and Endoglycan. CD34 is a well-known hematopoietic progenitor cell antigen. It is a sialomucin­like molecule that is heavily glycosylated with 9 potential N-linked glycosylation sites in the extracellular domain. In the cytoplasmic region, CD34 contains serine residues that can be phosphorylated by PKC (protein kinase C), resulting in the recruitment of the hematopoietic adapter proteins and the activation of CD34 signaling pathways. CD34 is expressed on primitive hematopoietic stem cells and down-regulated as they differentiate into mature cells. The precise function of CD34 remains unclear. The pattern of CD34 expression suggests that it plays an important role in hematopoiesis. CD34 is found on multipotent precursors, bone marrow stromal cells, embryonic fibroblasts, vascular endothelia, mesenchymal stem cells, and some tumor cell lines. CD34 is involved in the adhesion of stem cells to the bone marrow extracellular matrix or to stromal cells. It can act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. CD34 is overexpressed in many types of tumors and implicated in leukemogenesis.

Gene Symbol :
The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 – Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.

NCBI Gene ID :
947

Uniprot Entry :
P28906

Construct Details :
The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 – Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.

Source :
Human cells stably expressing human CD34 ECD and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQ SQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICL EQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLG ILDFTEQDVASHQSYSQKTSTTENLYFQGSTGHHHHHHHH

M.W. :
Calculated molecular mass (kDa): 30; Estimated by SDS-PAGE under reducing condition (kDa): 75-90 suggesting that the protein may be heavily glycosylated

Calculated PI :
6.16

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 7825

Endotoxin Level :
>92% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Interacts with L-selectin and supports the adhesion of the human umbilical vein endothelial cell line (HUVEC). Binds anti-CD34 monoclonal antibodies, human IgG1 (SKU#MAB0820) and rabbit IgG (SKU#MAB1713) by ELISA with this immobilized protein.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD34

Research Area :
Stem Cell

Pathway/Disease :
Hemopoiesis

Species :
Human

CD Antigen :
CD34

References :
1. Leukemia 2:793-803(1988). 2. J. Biol. Chem. 265:11056-61 (1990). 3. J. Immunol. 148:267-271(1992) 4. Blood 80:3051-59 (1992). 5. Blood 95:756-768 (2000).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TNF-alpha/TNFSF2 Protein
Animal-Free IL-19 Protein
Popular categories:
Thyroxine-Binding Globulin
CD4

Share this post on: