Name :
Human SIGIRR Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
SIGIRR (single immunoglobulin IL-1 receptor-related molecule) is a single-pass type III membrane protein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region and an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. Although SIGIRR contains the conserved Ig-like and TOR motifs, it differs from the other 9 members by having only one Ig-like domain. Human SIGIRR lacks signal peptide and contains a cytoplasmic extention beyond the TIR domain, which is reminiscent of the structure of Toll and Tolllike receptor family members but absent in most IL1 receptor family members. SIGIRR is widely expressed in mouse and human epithelial tissues, such as kidney, lung and gut. The ligand and signaling mechanism for SIGIRR remain unclear. SIGIRR may act as a negative regulator for Toll-IL-1R signaling by trapping the crucial components of the pathway. Inflammation is enhanced in SIGIRR-deficient mice, as demonstrated by the increased chemokine induction after IL-1 injection and reduced threshold for lethal endotoxin challenge. SIGIRR may plays critical role in gut homeostasis, intestinal inflammation, and colitis-associated tumorigenesis by maintaining the microbial tolerance of the colonic epithelium. Moreover, SIGIRR-deficient mice developed stronger Th2 immune response, suggesting that SIGIRR is an important regulator of Th2, possibly through its impact on IL-33-mediated signaling pathway.
Gene Symbol :
The recombinant human SIGIRR ECD is expressed as a 357 amino acid protein consisting of Met1 His118 region of SIGIRR (UniProt accession #Q6IA17) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
59307
Uniprot Entry :
Q6IA17
Construct Details :
The recombinant human SIGIRR ECD is expressed as a 357 amino acid protein consisting of Met1 His118 region of SIGIRR (UniProt accession #Q6IA17) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human IL1RAP-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIgGHYSLHEYSWVK ANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHGSTTENLYFQGSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK
M.W. :
Calculated molecular mass (kDa): 39.3; Estimated by SDS-PAGE under reducing condition (kDa): ~55 (probably due to glycosylation).
Calculated PI :
6.26
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 57870
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Not available.
Molecule Class :
1-Pass Type III Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
TIR8; UNQ301/PRO342
Research Area :
Immunology
Pathway/Disease :
IL1R/TLR Signaling Pathway
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin alpha 6 beta 1 Protein
EGFR vIII Protein
Popular categories:
Nemo Like Kinase
Cadherin-4