Name :
Human PD-1 protein (extracellular domain), Fc-fusion, recombinant
Description :
Programmed death-1 (PD-1), also known as programmed cell death 1 (PDCD1) or CD279, is a single pass type I transmembrane glycoprotein of the Ig superfamily. It is an immunoreceptor in the CD28/CTLA-4 family with an IgV-type extracellular domain showing 21–33% sequence identity with CTLA-4, CD28 and ICOS. Members of the CD28/CTLA-4 family have been shown to either promote T cell activation (CD28 and ICOS) or inhibit T cell activation (CTLA4 and PD1). The cytoplasmic domain of PD-1 contains two tyrosine residues, a membrane-proximal immunoreceptor tyrosine-based inhibitory motif (ITIM) and an immunoreceptor tyrosine-based switch motif (ITSM). ITIM is widely found in immunoinhibitory receptors and the membrane-proximal tyrosine residue may play a central role for the inhibitory function of PD-1. PD-1 negatively regulates antigen receptor signaling by recruiting protein tyrosine phosphatase upon engaging with either of two ligands, PD-L1 or PD-L2. It inhibits the T-cell proliferation and production of related cytokines such as IL-1, IL-4, IL-10 and IFN-γ. PD-1 is involved in lymphocyte clonal selection and peripheral tolerance, and thus contributes to the prevention of autoimmune diseases. As a negative regulator of T- cell effector mechanisms, PD-1 may lead to suppression of anti-tumor immunity. Blockade of PD-1 inhibitory activity with antibodies enhances anti-tumor immunity in vivo. PD-1 has been proposed as a promising target for cancer immunotherapy.
Gene Symbol :
NCBI Gene ID :
5133
Uniprot Entry :
Q15116
Construct Details :
The recombinant protein is expressed as a 376-amino acid protein consisting of Pro21 – Thr168 region of PD-1 or CD279 (UniProt accession #Q15116) and a C-terminal Fc from human IgG1, which exists as a homodimer under non-reducing conditions.
Source :
Human cells stably expressing PD-1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
PGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFR VTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTSTGT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated PI :
8.73
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier- and preservative-free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its ligands PD-L1 (SKU#: FCL0781), PD-L2 (SKU#FCL783) and anti-PD-1 monoclonal antibodies (SKU#: MAB1732, MAB0761, MAB0763). Blocks PD-1’s binding to its ligands, PD-L1 and PD-L2 and their signaling activities. Shows cross-species binding to both human and mouse PD-L1 (SKU#FCL1846) and PD-L2 (SKU#FCL1818) in a functional ELISA (see Technical Data). Exhibits immunosuppressive activity in vivo.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD279, PDCD1, PD1, SLEB2, hPD-1, hPD-l, hSLE1
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD279
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free FGF-4 Protein
IGFBP-6 Protein
Popular categories:
Complement Component 3
Immunoglobulin-like Cell Adhesion Molecules
