Share this post on:

Name :
Human IL1R1 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
IL1R1 (interleukin 1 receptor, type I), also known as CD121a, is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region. Most members also have an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. There are two distinct types of receptors for the pleiotropic cytokines IL1α and IL1β: the type I (IL1R1) is an 80 kDa transmembrane protein expressed predominantly in T cells, fibroblasts, and endothelial cells and mediates all the known IL-1 biological functions while the type II (IL1R2) is a 68 kDa transmembrane protein with a short cytoplamic domain and serves as a decoy receptor for IL1. Both receptors are members of the immunoglobulin superfamily (IgSF). However the two receptors do not heterodimerize into a receptor complex. IL1R1 acts as a receptor for both IL-1α and IL-1β through the association with the co-receptor IL1RAP (interleukin 1 receptor antagonist protein). IL1R1 and IL1RAP together form a high affinity IL-1 receptor complex, which mediates IL-1-dependent activation of NF-κB, MAPK and other signaling pathways. IL-1R1 signaling involves the recruitment of adapter molecules, such as MYD88 and IRAK1/IRAK2, via the respective TIR domains. IL1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. Recombinant soluble form of IL1R1 has been shown to be a potent antagonist of IL1 action.

Gene Symbol :
The recombinant human IL1R1 ECD is expressed as a 557 amino acid protein consisting of Leu18 ­Lys336 region of IL1R1 (UniProt accession #P14778) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
3554

Uniprot Entry :
P14778

Construct Details :
The recombinant human IL1R1 ECD is expressed as a 557 amino acid protein consisting of Leu18 ­Lys336 region of IL1R1 (UniProt accession #P14778) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human RSPO1-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAK VEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPK LQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPV IVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLN ISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKSTTENLYFQGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 63.4; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).

Calculated PI :
6.50

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 90730

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Interacts with human IL1α and IL1β, and blocks IL1-dependent signaling activity with a typical ED50 of 0.3 – 0.8 µg/ml

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD121a; P80; IL1R; IL1RA; IL1RT1; D2S1473; IL-1R-α; IL-1R-1; IL-1RT-1; IL-1R1

Research Area :
Immunology

Pathway/Disease :
IL1R/TLR Signaling Pathway

Species :
Human

CD Antigen :
CD121a

References :
1. J. Biol. Chem. 270:13757 (1995). 2. J. Biol. Chem. 272 : 29167-73 (1997). 3. Proc. Natl. Acad. Sci. 94: 12829-32 (1997). 4. Nature. 386:190-194 (1997). 5. Nature. 386:194-200 (1997).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin B Protein
TNF RI/TNFRSF1A Protein
Popular categories:
Cathepsin X/Cathepsin Z
IFN-lambda 3/IL-28B

Share this post on: