Name :
Human IL1R1 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
IL1R1 (interleukin 1 receptor, type I), also known as CD121a, is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region. Most members also have an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. There are two distinct types of receptors for the pleiotropic cytokines IL1α and IL1β: the type I (IL1R1) is an 80 kDa transmembrane protein expressed predominantly in T cells, fibroblasts, and endothelial cells and mediates all the known IL-1 biological functions while the type II (IL1R2) is a 68 kDa transmembrane protein with a short cytoplamic domain and serves as a decoy receptor for IL1. Both receptors are members of the immunoglobulin superfamily (IgSF). However the two receptors do not heterodimerize into a receptor complex. IL1R1 acts as a receptor for both IL-1α and IL-1β through the association with the co-receptor IL1RAP (interleukin 1 receptor antagonist protein). IL1R1 and IL1RAP together form a high affinity IL-1 receptor complex, which mediates IL-1-dependent activation of NF-κB, MAPK and other signaling pathways. IL-1R1 signaling involves the recruitment of adapter molecules, such as MYD88 and IRAK1/IRAK2, via the respective TIR domains. IL1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. Recombinant soluble form of IL1R1 has been shown to be a potent antagonist of IL1 action.
Gene Symbol :
The recombinant human IL1R1 ECD is expressed as a 557 amino acid protein consisting of Leu18 Lys336 region of IL1R1 (UniProt accession #P14778) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
3554
Uniprot Entry :
P14778
Construct Details :
The recombinant human IL1R1 ECD is expressed as a 557 amino acid protein consisting of Leu18 Lys336 region of IL1R1 (UniProt accession #P14778) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human RSPO1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAK VEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPK LQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPV IVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLN ISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKSTTENLYFQGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 63.4; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).
Calculated PI :
6.50
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 90730
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Interacts with human IL1α and IL1β, and blocks IL1-dependent signaling activity with a typical ED50 of 0.3 – 0.8 µg/ml
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD121a; P80; IL1R; IL1RA; IL1RT1; D2S1473; IL-1R-α; IL-1R-1; IL-1RT-1; IL-1R1
Research Area :
Immunology
Pathway/Disease :
IL1R/TLR Signaling Pathway
Species :
Human
CD Antigen :
CD121a
References :
1. J. Biol. Chem. 270:13757 (1995). 2. J. Biol. Chem. 272 : 29167-73 (1997). 3. Proc. Natl. Acad. Sci. 94: 12829-32 (1997). 4. Nature. 386:190-194 (1997). 5. Nature. 386:194-200 (1997).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin B Protein
TNF RI/TNFRSF1A Protein
Popular categories:
Cathepsin X/Cathepsin Z
IFN-lambda 3/IL-28B
