Share this post on:

Name :
Human TGFBR2 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. TGFBR2 (transforming growth factor β receptor 2), also known as TGFR-2 and TGFβ-RII, is a type II receptor for TGFβ that functions as a tumor suppressor by inhibiting the cell cycle in the G1 phase. TGFBR2 binds TGFβ1, TGFβ3, and TGFβ5 with high affinity, and TGFβ2 with two orders of magnitude lower affinity. TGFBR2 regulates a plethora of physiological and pathological processes, including wound healing, extracellular matrix production, immunosuppression, and tumorigenesis. Mutations in the TGFBR2 gene are associated with Marfan syndrome (MFS), Loeys-Deitz Aortic Aneurysm Syndrome (LDS), thoracic aortic aneurysms and dissection (TAAD), thoracic aortic aneurysms type 3 (AAT3) and cancers, such as hereditary non-polyposis colorectal cancer 6 (HNPCC6) and esophageal cancer (ESCR).

Gene Symbol :

NCBI Gene ID :
7048

Uniprot Entry :
P37173

Construct Details :
The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 – Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image above, labeled as “DTT: -“).

Source :
Human cells stably expressing human TGFBR2-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEK PQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC SCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60

Calculated PI :
5.84

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 45015

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized TGFBR2 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.

Molecule Class :
Serine/Threonine Kinase Receptor

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFBRII; TGFbeta-RII

Research Area :
Development

Pathway/Disease :
TGFβ Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Cell 68:775-785(1992) 2. Nat. Genet. 19:17(1998) 3. Cancer Res. 61:482(2001) 4. Nat. Genet. 36:855(2004) 5. Nat. Genet. 37:275(2005)

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Vitamin D-binding protein/GC Protein
HGFR Protein
Popular categories:
MDL-1/CLEC5A
PD-L1/CD274

Share this post on: