Name :
Human HER3 protein (extracellular domain), recombinant
Description :
HER3 is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK). Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4). They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity. EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation. HER3 binds neuregulins NRG1 and NRG2, but lacks an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, heterodimerization with other EGF receptor family members, which have kinase activity, leads to the activation of pathways. Amplification or overexpression of this gene has been reported in several cancers, including lung, prostate, bladder, and breast tumors. HER3 is also genetically linked to type 1 diabetes and lethal congenital contracture syndrome-2 (LCCS2).
Gene Symbol :
NCBI Gene ID :
2065 (human)
Uniprot Entry :
P21860 (human)
Construct Details :
The recombinant human HER3 extracellular or ecto-domain (ECD) is expressed as a 635 amino acid protein consisting of Ser20-Thr643 region of HER3 and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions
Source :
Human cells stably expressing HER3 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNL RVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPP CHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKL TFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGF VNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMK NLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQC LSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 70.0; Estimated by SDS-PAGE under reducing condition (kDa): ~75
Calculated PI :
6.66
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 66955
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
It is reported to inhibit the biological activity of Neuregulin-1 on MCF‑7 human breast cancer cells
Molecule Class :
Receptor Tyrosine Kinase (RTK)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
HER3; ERBB3; LCCS2; ErbB-3; c-erbB3; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Research Area :
Cancer
Pathway/Disease :
EGF/PDGF Signaling Pathway
Species :
Human
CD Antigen :
References :
1. J. Biol. Chem. 269: 14303-14306, 1994.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PLA2G7 Protein
IL-4R alpha/CD124 Protein
Popular categories:
IL-4 Receptor
MSR1/CD204