Name :
Human NECL3 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
NECL3 (Nectin-like protein 3), also known as IgSF4D and CADM2 (cell adhesion molecule 2), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL3 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. The expression and function of NECL3 has not been well characterized. It is found in the axoplasm of myelinated axons. It may play an mportant role in synapse organization, providing regulated trans-synaptic adhesion. NECL3 contains a cytoplasmic domain with protein 4.1 and PDZ domain binding sites, allowing connections to adaptor molecules that are critical for synaptogenesis.
Gene Symbol :
NECL3; CADM2; IGSF4D; Necl-3; synCAM2; SynCAM-2
NCBI Gene ID :
253559
Uniprot Entry :
Q8N3J6
Construct Details :
The recombinant human NECL3-Fc fusion protein is expressed as a 572-amino acid protein consisting of Gln25 – His367 region of NECL3 (UniProt accession #Q8N3J6) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human NECL3-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSD EGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYL KEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLIL TCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTL LPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNGPDHGSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 63.2; Estimated by SDS-PAGE under reducing condition (kDa): 80-65
Calculated PI :
5.65
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 68590
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CADM2; IGSF4D; Necl-3; synCAM2; SynCAM-2
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
References :
1. Curr. Opin. Cell Biol. 16:513 (2004). 2. J. Cell Sci. 118:1267 (2004). 3. Genomics 87:139 (2006). 4. BMC Neurosci. 8:90-90(2007).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PNLIP/Pancreatic lipase Protein
MME Protein
Popular categories:
SR-PSOX/CXCL16
IL-1RA