Name :
Human MSLN/Mesothelin protein, biotinylated, recombinant
Description :
Mesothelin (MSLN) is a glycosylphosphatidylinositol (GPI)-anchored glycoprotein that is expressed on mesothelial cells in the pleura, pericardium and peritoneum. It is overexpressed in mesotheliomas, ovarian and pancreatic cancers as well as in specific squamous cell carcinomas. The MSLN gene encodes a precursor protein that is cleaved into two products, megakaryocyte-potentiating factor (MPF) and MSLN. MPF is secreted and functions as a cytokine that can stimulate colony formation in bone marrow megakaryocytes. The cleaved form of MSLN remains GPI-anchored on cell-surface and may function as a cell adhesion molecule. Alternative splicing results in multiple transcript variants. Two variant forms exist; variant 1 has an eight amino acid insertion and is rarely expressed, while variant 2 is a truncated form found in cancers but rarely detected in normal individuals. MSLN interacts with CA125/MUC16 and potentiates megakaryocyte colony formation in vitro. MSLN is secreted by several mesothelioma cell lines and is frequently elevated in the blood of patients with mesothelioma. Measurement of this protein may be useful in following the response of mesothelioma to treatment.
Gene Symbol :
NCBI Gene ID :
10232
Uniprot Entry :
Q13421
Construct Details :
The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 – Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites.
Source :
Human cells stably expressing human MSLN and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYL FLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPS SIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLT VAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSTTENLYFQGSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50
Calculated PI :
5.62
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 38640
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 (SKU#: MAB1458) with high affinity KD
Molecule Class :
GPI-anchored Protein
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
MSLN; MPF; SMRP; CAK1
Research Area :
Cancer
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
References :
1. J. Biol. Chem. 269:805-808 (1994) 2. J. Biol. Chem. 270:21984-21990 (1995) 3. Clin. Cancer Res. 12:4225-4231 (2006) 4. Proc. Natl. Acad. Sci. 96:11531-11536 (1999)
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
WWP2 Protein
IFN-lambda 1/IL-29 Protein
Popular categories:
MCP-2 Protein/CCL8
HPV Proteins