Share this post on:

Name :
Human BMPR1B/ALK6 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. The type I receptors are also referred to as ALKs (activin receptor-like kinases). Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. BMPR1B (BMP receptor type IB), also known as ALK6 and CDw293, is a type I receptor for BMPs that are involved in endochondral bone formation and embryogenesis. BMPR1B is expressed in various tissues during embryogenesis but only found in the brain in adult tissues. The extracellular domain of BMPR1B shares little amino acid sequence identity with other TGFBRs, except the cysteine residues are conserved. BMPR1B is involved in pre-cartilaginous condensations. Soluble BMPR1B binds BMP4 and is a potent BMP4 antagonist. Mutations in BMPR1B are associated with primary pulmonary hypertension, acromesomelic chondrodysplasia with genital anomalies (AMDGA) and brachydactyly A2 (BDA2). Reduced BMPR1B expression correlates with a poor prognosis of breast cancer.

Gene Symbol :
BMPR1B; CDw293; ALK6; ALK-6; BMPR-1B; BMPRIB; BMPR-IB

NCBI Gene ID :
658

Uniprot Entry :
O00238

Construct Details :
The recombinant human BMPR1B-Fc fusion protein is expressed as a 342 amino acid protein consisting of Lys14 – Arg126 region of BMPR1B (UniProt accession #O00238) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition

Source :
Human cells stably expressing human BMPR1B-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
KKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVV TSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDG PIHHRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~45

Calculated PI :
6.29

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 37900

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Recombinant BMPR1B protein binds human BMP4 and blocks BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells)

Molecule Class :
Serine/Threonine Kinase Receptor

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CDw293; ALK6; ALK-6; BMPR-1B; BMPRIB; BMPR-IB

Research Area :
Development

Pathway/Disease :
BMP Signaling Pathway

Species :
Human

CD Antigen :
CDw293

References :
1. J. Biol. Chem. 279:27560 (2004). 2. Proc. Natl. Acad. Sci. 100:12277(2003) 3. J. Med. Genet. 42:314-317(2005). 4. Proc. Natl. Acad. Sci. 102:5062(2005). 5. Cancer Genomics Proteomics 6:101(2009).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-15R alpha Protein
Cathepsin L2 Protein
Popular categories:
IL-13
M-CSF

Share this post on: