Name :
Human BMPR1A/ALK3 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. The type I receptors are also referred to as ALKs (activin receptor-like kinases). Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. BMPR1A (BMP receptor type IA), also known as ALK3, ACVRLK3, SKR5 and CD292, is a type I receptor for BMPs that are involved in endochondral bone formation and embryogenesis. BMPR1A is required for the proper development of the anteriorposterior axis and the morphogenesis of the heart, lung, palate, teeth, and bone. Mutations in the BMPR1A gene are associated with Juvenile polyposis syndrome (JPS) and polyposis syndrome mixed hereditary 2 (HMPS2). BMPR1A may play a role in glucosestimulated insulin secretion, scar formation, osteoclast activity and bone remodeling, as well as ovulation and fertility. BMPR-1A may be an indicator of osteoarthritis progression and a reduction in the expression of BMPRIA is associated with a poorer prognosis in pancreatic cancer.
Gene Symbol :
BMPR1A; CD292; ALK3; ALK-3; SKR5; ACVRLK3; BMPR-1A; BMPR1A; BMPR-IA; 10q23del
NCBI Gene ID :
657
Uniprot Entry :
P36894
Construct Details :
The recombinant human BMPR1A-Fc fusion protein is expressed as a 354 amino acid protein consisting of Gln24 – Ser150 region of BMPR1A (UniProt accession #P36894) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image above, labeled as “DTT: -“).
Source :
Human cells stably expressing human BMPR1A-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTC ITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNL CNQYLQPTLPPVVIGPFFDGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
Calculated PI :
5.72
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 40880
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Recombinant BMPR1A protein binds human BMP2 and BMP4, and blocks BMP2/BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells)
Molecule Class :
Serine/Threonine Kinase Receptor
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD292; ALK3; ALK-3; SKR5; ACVRLK3; BMPR-1A; BMPR1A; BMPR-IA; 10q23del
Research Area :
Development
Pathway/Disease :
BMP Signaling Pathway
Species :
Human
CD Antigen :
CD292
References :
1. Oncogene 8:2879 (1993). 2. Proc. Natl. Acad. Sci. 99:2878 (2002). 3. Dev. Biol. 341:246 (2010). 4. Mol. Endocrinol. 24:1251 (2010). 5. Br. J. Cancer.109:1805 (2013).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MMP-1 Protein
Cystatin SN/CST1 Protein
Popular categories:
FGF-3
CCL21