Share this post on:

Name :
Human CDNF protein, recombinant

Description :
CDNF (cerebral dopamine neurotrophic factor or conserved dopamine neurotrophic factor) is also known as ARMETL1 (arginine­rich, mutated in early stage tumors­-like 1) in mouse. Mature CDNF protein consists of 161 amino acid residues (its precursor has 187 amino acids), and shares 62% amino acid (aa) identity with human MANF (mesencephalic­ astrocyte­derived neurotrophic factor), termed ARMET in mouse. CDNF was first identified by bioinformatics and then biochemically characterized. Vertebrates appear to have CDNF and MANF genes, whereas invertebrates have a single homologous gene more closely related to MANF than to CDNF. Mature human CDNF shares 80%, 84%, 90% and 92% aa identity with mouse, rat, equine and bovine CDNF, respectively. Human CDNF contains one potential N-linked glycosylation site, and both unglycosylated and glycosylated form of human CDNF is secreted from transiently overexpressing cells. Both CDNF and MANF have a high proportion of charged residues, a pattern of eight cysteines shown to form intramoleculular disulfides, and a C-­terminal endoplasmic reticulum retention signal. The CDNF gene is widely expressed in neuronal and non-neuronal tissues. In the brain, highest levels in the optic nerve and corpus callosum. Although CDNF mRNA and protein are expressed in pre­ and post­natal mouse brain, they are most abundant in adult heart, skeletal muscle and testis. Similar to MANF and GDNF, CDNF promotes survival of dopaminergic neurons in vitro. In a rat Parkinson’s disease model, CDNF also promotes rescue and restoration of dopaminergic neurons in vivo.

Gene Symbol :

NCBI Gene ID :
441549

Uniprot Entry :
Q49AH0

Construct Details :
The recombinant human CDNF is expressed as a 174 amino acid protein consisting of Gln25 – Leu187 region of CDNF (UniProt entry Q49AH0) and a C-terminal poly-Histidine tag.

Source :
Human cells stably expressing CDNF and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVH MPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTELS TGHHHHHHHH M.W.: Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state. Calculated PI: 7.75 Calculated Extinction Coefficient: 14940 (M-1 cm-1, at 280nm) Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, sample is labeled as “S” and “M” stands for markers) Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free) Endotoxin Level: Biological Activity: CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 ­ – 24 μg/mL on a nitrocellulose­ coated microplate

M.W. :
Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state.

Calculated PI :
7.75

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, sample is labeled as “S” and “M” stands for markers)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 ­ – 24 μg/mL on a nitrocellulose­ coated microplate

Molecule Class :
Neurotrophic Growth Factor (secreted)

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CDNF; ARMETL1

Research Area :
Neuroscience

Pathway/Disease :
Neurological Development & Degenerative Disease

Species :
Human

CD Antigen :

References :
1. Develop Neurobiol 70: 360, 2010

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
S100A13 Protein
PDGF-CC Protein
Popular categories:
CD151
CD138/Syndecan-1

Share this post on: