Share this post on:

Name :
Human ACVR2A Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. ACVR2A (Activin receptor type-2A), also known as ACVR2 and ACTRIIA, is a type II receptors for Activins and Inhibins as well as several other members of the TGFβ superfamily proteins. Following the binding to dimeric Activin ligands, ACVRIIA then associates with a type I receptor to initiate signal transduction. Human, mouse and rat ACVRIIA share greater than 98% amino acid sequence homology. Recombinant soluble ACVRIIA bind activin with high affinity, and are potent activin antagonists. ACVR2A may function as a tumor suppressor that is frequently mutated in microsatellite-unstable colon cancers. Inactivation of ACVR2A is also a common event in prostate cancer cells. ACVR2A may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality.

Gene Symbol :
ACVR2A; ACVR2; ACTRII; ActR-II; ACTRIIA; ActR-IIA; ACVRIIA; ACVR-IIA

NCBI Gene ID :
92

Uniprot Entry :
P27037

Construct Details :
The recombinant human ACVR2A-Fc fusion protein is expressed as a 344 amino acid protein consisting of Ala20 – Pro135 region of ACVR2A (UniProt accession #P27037) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image above, labeled as “DTT: -“)

Source :
Human cells stably expressing human ACVR2A-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEME VTQPTSNPVTPKPPSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): ~55

Calculated PI :
5.97

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 58870

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized ACVR2A binds Activin or Inhibin in a functional ELISA. Neutralize Activin-induced inhibition of MPC11 cell proliferation and hemoglobin expression in K562 human chronic myelogenous leukemia cells.

Molecule Class :
Serine/Threonine Kinase Receptor

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
ACVR2; ACTRII; ActR-II; ACTRIIA; ActR-IIA; ACVRIIA; ACVR-IIA

Research Area :
Development

Pathway/Disease :
Activin/TGFβ Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Nature 401:480 (1999). 2. J. Biol. Chem. 274:584 (1999). 3. Nature 404:411 (2000). 4. Proc. Natl. Acad. Sci. 100:5193 (2003). 5. Cytokine Growth Factor Rev. 17:157 (2006).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FCGRT-B2M Heterodimer Protein
CCL1 Protein
Popular categories:
IFN-alpha 16
TGF-β1

Share this post on: