Name :
Human FGFR3 Protein, ECD (Extracellular Domain), Recombinant
Description :
FGFR3 (fibroblast growth factor receptor 3), also known as JTK4 and CD333, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family. There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)like domains, an acidbox region, a transmembrane domain and a cytoplasmic tyrosinekinase domain. FGFR3 is expressed in liver, lung, kidney, testis, ovary and uterus , with highest levels in brain in adults. FGFR3 is a receptor for acidic and basic fibroblast growth factors, and preferentially binds to FGF1. It plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. FGFR3 regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Defects in FGFR3 are associated with many diseases, such as achondroplasia (ACH), Crouzon syndrome with acanthosis nigricans (CAN) and thanatophoric dysplasia type 1 (TD1). A chromosomal aberration involving FGFR3 is also found in multiple myeloma.
Gene Symbol :
The recombinant human FGFR3 ECD protein is expressed as a 364 amino acid protein consisting of Glu23 – Gly375 region of FGFR3 (Uniprot accession #P22607 – isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 8 potential N-linked glycosylation sites.
NCBI Gene ID :
2261
Uniprot Entry :
P22607
Construct Details :
The recombinant human FGFR3 ECD protein is expressed as a 364 amino acid protein consisting of Glu23 – Gly375 region of FGFR3 (Uniprot accession #P22607 – isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 8 potential N-linked glycosylation sites.
Source :
Human cells stably expressing FGFR3 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERV LVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPY WTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMES VVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQ PHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGF SHHSAWLVVLPAEEELVEADEAGSVYAGSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 39.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-60
Calculated PI :
5.52
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 45295
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecule Class :
Receptor Tyrosine Kinase (RTK)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
FGFR3; CD333; FGFR-3; ACH; CEK2; JTK4; JTK-4; HSFGFR3EX
Research Area :
Development
Pathway/Disease :
FGF/FGFR Signaling Pathway
Species :
Human
CD Antigen :
CD333
References :
1. Nature 371:252-254 (1994) 2. Nat. Genet. 9:321-328 (1995) 3. Nat. Genet. 11:462-464 (1995) 4. Nat. Genet. 16:260-264 (1997) 5. Trends Biochem. Sci. 23:59 (1998)
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Lacritin Protein
SULT2B1 Protein
Popular categories:
CD200R4
Fc Receptor Like 1 (FCRL1)
