Share this post on:

Name :
Human FGFR3 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
FGFR3 (fibroblast growth factor receptor 3), also known as JTK4 and CD333, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family. There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)­like domains, an acid­box region, a transmembrane domain and a cytoplasmic tyrosine­kinase domain. FGFR3 is expressed in liver, lung, kidney, testis, ovary and uterus , with highest levels in brain in adults. FGFR3 is a receptor for acidic and basic fibroblast growth factors, and preferentially binds to FGF1. It plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. FGFR3 regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Defects in FGFR3 are associated with many diseases, such as achondroplasia (ACH), Crouzon syndrome with acanthosis nigricans (CAN) and thanatophoric dysplasia type 1 (TD1). A chromosomal aberration involving FGFR3 is also found in multiple myeloma.

Gene Symbol :
The recombinant human FGFR3-Fc fusion protein is expressed as a 581 amino acid protein consisting of Glu23 – Gly375 region of FGFR3 (Uniprot accession #P22607 – isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
2261

Uniprot Entry :
P22607

Construct Details :
The recombinant human FGFR3-Fc fusion protein is expressed as a 581 amino acid protein consisting of Glu23 – Gly375 region of FGFR3 (Uniprot accession #P22607 – isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing FGFR3-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSER VLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGA PYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLV MESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVY SDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAG NSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK

M.W. :
Calculated molecular mass (kDa): 63.7; Estimated by SDS-PAGE under reducing condition (kDa): 80-90

Calculated PI :
5.57

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 81080

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.05 – 0.3 μg/ml

Molecule Class :
Receptor Tyrosine Kinase (RTK)

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
FGFR3; CD333; FGFR-3; ACH; CEK2; JTK4; JTK-4; HSFGFR3EX

Research Area :
Development

Pathway/Disease :
FGF/FGFR Signaling Pathway

Species :
Human

CD Antigen :
CD333

References :
1. Nature 371:252-254 (1994) 2. Nat. Genet. 9:321-328 (1995) 3. Nat. Genet. 11:462-464 (1995) 4. Nat. Genet. 16:260-264 (1997) 5. Trends Biochem. Sci. 23:59 (1998)

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CDK4 Protein
GCP-2/CXCL6 Protein
Popular categories:
Eotaxin-3/CCL26
Ubiquitin-Conjugating Enzyme E2 Z

Share this post on: