Name :
Human CD30 Protein, ECD (Extracellular Domain), Recombinant
Description :
CD30/TNFRSF8 is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). The ligand for CD30 is CD30L/CD153, a member of the TNF superfamily (TNFSF8). CD30L-CD30 ligation mediates pleiotropic effects, including cell proliferation, activation, differentiation and apoptosis. CD30 is expressed in activated, but not resting, T and B cells. CD30 can regulate proliferation of lymphocytes and may also play an important role in human immunodeficiency virus (HIV) replication. As a regulator of apoptosis, CD30 protein induces cell death or proliferation, depending on the cell type, and has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. CD30 contributes to thymic negative selection by inducing the apoptotic cell death of CD4+CD8+ T cells. In B cells, CD30 ligation promotes cellular proliferation and antibody production. CD30 is overexpressed in various hematological malignancies, including Reed-Sternberg cells in Hodgkin’s disease (HD), anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin’s lymphomas (NHLs). CD30 is also found in leukocytes in patients with chronic inflammatory diseases, including lupus erythematosus, asthma, rheumatoid arthritis and atopic dermatitis.
Gene Symbol :
The recombinant human CD30 ECD is expressed as a 368 amino acid protein consisting of Phe19 – Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal His-tag. It contains 2 potential sites for N-linked glycosylation.
NCBI Gene ID :
943
Uniprot Entry :
P28908
Construct Details :
The recombinant human CD30 ECD is expressed as a 368 amino acid protein consisting of Phe19 – Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal His-tag. It contains 2 potential sites for N-linked glycosylation.
Source :
Human cells stably expressing human CD30 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVT CSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASP GVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPS SDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICA TSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDS QASKTLPIPTSAPVALSSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 70-80
Calculated PI :
6.13
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 25045
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies (SKU#MAB1173, #MAB1174, #MAB1176) with high affinity. Blocks CD30 Ligand-induced IL6 secretion by human Hodgkin’s lymphoma cells
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD30; Ki-1; TNFRSF8; D1S166E
Research Area :
Cancer
Pathway/Disease :
Immune Response
Species :
Human
CD Antigen :
CD30
References :
1. Cell 68:421 (1992). 2. J. Immunol. 156:1387 (1996). 3. Proc. Natl. Acad. Sci. 93 (24): 14053 (1996). 4. J. Biol. Chem. 271 (22): 12852 (1996). 5. Immunology 118:143 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-35 Protein
Fc gamma RIIB/CD32b Protein
Popular categories:
Breast Tumor Kinase
BTN2A2