Share this post on:

Name :
Human SLAMF9 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
SLAMF9 (signaling lymphocytic activation molecule family member ), also known as CD2F-10 and CD84-H1, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF9 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region but lacks ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF9 is predominantly expressed in hematopoietic tissues and immune cells, including monocytes, dendritic, B- and T-cells as well as leukocyte cell line THP-1. SLAMF9 may play a role in the immune response.

Gene Symbol :
The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 – Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
89886

Uniprot Entry :
Q96A28

Construct Details :
The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 – Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human SLAMF9-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
RRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDP SYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMD MTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFGST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK

M.W. :
Calculated molecular mass (kDa): 49.6; Estimated by SDS-PAGE under reducing condition (kDa): 65-75

Calculated PI :
5.60

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 89560

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized SLAMF9 interacts homophilically with SLAMF9 in a functional ELISA and inhibits anti­-CD3e antibody induced IL­2 secretion by human T cells

Molecule Class :
1-pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD2F10; CD2F-10; CD84H1; CD84-H1; SF2001; CD2F-10; CD84-H1; UNQ1938/PRO4421

Research Area :
Immunology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :

References :
1. Immunogenetics 53:599 (2001). 2. Clin. Cancer Res. 7:822s (2001). 3. Adv Immunol. 97:177-250 (2008). 4. Annu. Rev. Immunol. 29:665 (2011).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-18BP Protein
MCR-1 protein
Popular categories:
CD31/PECAM-1
Dual Specificity Protein Phosphatase 14 (DUSP14)

Share this post on: